Lineage for d2g4sa1 (2g4s A:1-85)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540721Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2540737Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2540787Protein automated matches [190335] (3 species)
    not a true protein
  7. 2540792Species Human (Homo sapiens) [TaxId:9606] [187157] (2 PDB entries)
  8. 2540793Domain d2g4sa1: 2g4s A:1-85 [164582]
    Other proteins in same PDB: d2g4sa2
    automated match to d1wj6a_
    complexed with acy, cl

Details for d2g4sa1

PDB Entry: 2g4s (more details), 2.15 Å

PDB Description: Anomalous substructure of NBR1PB1
PDB Compounds: (A:) Next to BRCA1 gene 1 protein

SCOPe Domain Sequences for d2g4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4sa1 d.15.2.2 (A:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsins
qgeyeealkmavkqgnqlqmqvheg

SCOPe Domain Coordinates for d2g4sa1:

Click to download the PDB-style file with coordinates for d2g4sa1.
(The format of our PDB-style files is described here.)

Timeline for d2g4sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g4sa2