Lineage for d2g3za_ (2g3z A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113484Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 1113485Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1113506Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
    Uniprot P02766 31-143
  8. 1113740Domain d2g3za_: 2g3z A: [164576]
    automated match to d1eta1_
    mutant

Details for d2g3za_

PDB Entry: 2g3z (more details), 1.9 Å

PDB Description: crystal structure of transthyretin mutant i84a at low ph
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d2g3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3za_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgaspfhehaevvftandsgprrytiaallspysysttavvt

SCOPe Domain Coordinates for d2g3za_:

Click to download the PDB-style file with coordinates for d2g3za_.
(The format of our PDB-style files is described here.)

Timeline for d2g3za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g3zb_