Lineage for d2g3ha_ (2g3h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689438Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187733] (2 PDB entries)
  8. 2689440Domain d2g3ha_: 2g3h A: [164573]
    automated match to d1ecaa_
    complexed with cl, cyn, hem, mg

Details for d2g3ha_

PDB Entry: 2g3h (more details), 1.4 Å

PDB Description: cyanide binding and heme cavity conformational transitions in drosophila melanogaster hexa-coordinate hemoglobin
PDB Compounds: (A:) globin

SCOPe Domain Sequences for d2g3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3ha_ a.1.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mnsdevqlikktweipvatptdsgaailtqffnrfpsnlekfpfrdvpleelsgnarfra
hagriirvfdesiqvlgqdgdlekldeiwtkiavshiprtvskesynqlkgvildvltaa
ssldesqaatwaklvdhvygiifkaidddgnak

SCOPe Domain Coordinates for d2g3ha_:

Click to download the PDB-style file with coordinates for d2g3ha_.
(The format of our PDB-style files is described here.)

Timeline for d2g3ha_: