Lineage for d2g36a1 (2g36 A:1-328)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105469Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2105553Species Thermotoga maritima [TaxId:2336] [187734] (1 PDB entry)
  8. 2105554Domain d2g36a1: 2g36 A:1-328 [164572]
    Other proteins in same PDB: d2g36a2
    automated match to d1m83a_
    complexed with sf4, trp

Details for d2g36a1

PDB Entry: 2g36 (more details), 2.5 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase (ec 6.1.1.2) (tryptophan-trna ligase)(trprs) (tm0492) from thermotoga maritima at 2.50 a resolution
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2g36a1:

Sequence, based on SEQRES records: (download)

>d2g36a1 c.26.1.1 (A:1-328) Tryptophanyl-tRNA synthetase (TrpRS) {Thermotoga maritima [TaxId: 2336]}
mrilsgmrptgklhighlvgalenwvklqeegnecfyfvadwhaltthyddvsklkeytr
dlvrgflacgidpeksvifvqsgvkehaelallfsmivsvsrlervptykeikselnykd
lstagfliypvlqaadiliykaegvpvgedqvyhieltreiarrfnylydevfpepeail
srvpklpgtdgrkmsksygniinleisekeleqtilrmmtdparvrrsdpgnpencpvwk
yhqafdiseeeskwvwegcttasigcvdckklllknmkrklapiwenfrkidedphyvdd
vimegtkkarevaaktmeevrramnlmf

Sequence, based on observed residues (ATOM records): (download)

>d2g36a1 c.26.1.1 (A:1-328) Tryptophanyl-tRNA synthetase (TrpRS) {Thermotoga maritima [TaxId: 2336]}
mrilsgmrptgklhighlvgalenwvklqeegnecfyfvadwhaltthyddvsklkeytr
dlvrgflacgidpeksvifvqsgvkehaelallfsmivsvsrlervptykeidlstagfl
iypvlqaadiliykaegvpvgedqvyhieltreiarrfnylydevfpepeailsrvpklp
gtdgrkmsksygniinleisekeleqtilrmmtdparvrrsdpgnpencpvwkyhqafdi
seeeskwvwegcttasigcvdckklllknmkrklapiwenfrkidedphyvddvimegtk
karevaaktmeevrramnlmf

SCOPe Domain Coordinates for d2g36a1:

Click to download the PDB-style file with coordinates for d2g36a1.
(The format of our PDB-style files is described here.)

Timeline for d2g36a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g36a2