Class a: All alpha proteins [46456] (258 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (4 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries) |
Domain d1eqzg_: 1eqz G: [16457] Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_ protein/DNA complex; complexed with cac, cl, k, mn; mutant |
PDB Entry: 1eqz (more details), 2.5 Å
SCOP Domain Sequences for d1eqzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqzg_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} prkqlatkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreia qdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1eqzg_: