Lineage for d2g2pa_ (2g2p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769750Species Escherichia coli [TaxId:562] [187730] (2 PDB entries)
  8. 2769755Domain d2g2pa_: 2g2p A: [164568]
    automated match to d1tfpa_
    complexed with br, so4, zn

Details for d2g2pa_

PDB Entry: 2g2p (more details), 2.1 Å

PDB Description: Crystal Structure of E.coli transthyretin-related protein with bound Zn and Br
PDB Compounds: (A:) transthyretin-like protein

SCOPe Domain Sequences for d2g2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2pa_ b.3.4.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
nilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattgdyr
vvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

SCOPe Domain Coordinates for d2g2pa_:

Click to download the PDB-style file with coordinates for d2g2pa_.
(The format of our PDB-style files is described here.)

Timeline for d2g2pa_: