SCOPe 2.05: Domain d2g2na_: 2g2n A:

Lineage for d2g2na_ (2g2n A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187730] (2 PDB entries)

8. Domain d2g2na_: 2g2n A: [164564]
   automated match to d1tfpa_
   complexed with so4, zn

Details for d2g2na_

PDB Entry: 2g2n, 1.65 Å

PDB Description: Crystal Structure of E.coli transthyretin-related protein with bound Zn

PDB Compounds: (A:) transthyretin-like protein

SCOPe Domain Sequences for d2g2na_:

Sequence; same for both SEQRES and ATOM records:

>d2g2na_ b.3.4.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
nilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattgdyr
vvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

Timeline for d2g2na_:

• d2g2na_ first appeared in SCOPe 2.01
  
• d2g2na_ appears in SCOPe 2.04
  
• d2g2na_ appears in SCOPe 2.06
  
• d2g2na_ appears in the current release, SCOPe 2.08