Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (9 PDB entries) |
Domain d2g2lb_: 2g2l B: [164563] automated match to d1qlca_ |
PDB Entry: 2g2l (more details), 2.35 Å
SCOPe Domain Sequences for d2g2lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g2lb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn svcleevtheeavtalkntsdfvylkvakp
Timeline for d2g2lb_: