Lineage for d2g2lb_ (2g2l B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312128Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1312422Protein automated matches [190055] (6 species)
    not a true protein
  7. 1312482Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (7 PDB entries)
  8. 1312493Domain d2g2lb_: 2g2l B: [164563]
    automated match to d1qlca_

Details for d2g2lb_

PDB Entry: 2g2l (more details), 2.35 Å

PDB Description: crystal structure of the second pdz domain of sap97 in complex with a glur-a c-terminal peptide
PDB Compounds: (B:) Synapse-associated protein 97

SCOPe Domain Sequences for d2g2lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2lb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svcleevtheeavtalkntsdfvylkvakp

SCOPe Domain Coordinates for d2g2lb_:

Click to download the PDB-style file with coordinates for d2g2lb_.
(The format of our PDB-style files is described here.)

Timeline for d2g2lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g2la_