Lineage for d2g2da_ (2g2d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318511Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2318530Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2318531Protein automated matches [190652] (6 species)
    not a true protein
  7. 2318568Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries)
  8. 2318571Domain d2g2da_: 2g2d A: [164561]
    automated match to d1rtyb_

Details for d2g2da_

PDB Entry: 2g2d (more details), 2 Å

PDB Description: Crystal structure of a putative pduO-type ATP:cobalamin adenosyltransferase from Mycobacterium tuberculosis
PDB Compounds: (A:) ATP:cobalamin adenosyltransferase

SCOPe Domain Sequences for d2g2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2da_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlfdagadlstpivenpkhp
plriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvartvvrraersawaavd
ahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpgg

SCOPe Domain Coordinates for d2g2da_:

Click to download the PDB-style file with coordinates for d2g2da_.
(The format of our PDB-style files is described here.)

Timeline for d2g2da_: