Lineage for d1eqzc_ (1eqz C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535113Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 535114Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 535115Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 535225Protein Histone H3 [47122] (3 species)
  7. 535270Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (5 PDB entries)
  8. 535275Domain d1eqzc_: 1eqz C: [16456]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_

Details for d1eqzc_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa
vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1eqzc_:

Click to download the PDB-style file with coordinates for d1eqzc_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzc_: