Lineage for d2g1ra_ (2g1r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1797457Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1797924Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 1797932Species Human (Homo sapiens) [TaxId:9606] [50669] (66 PDB entries)
  8. 1797967Domain d2g1ra_: 2g1r A: [164543]
    automated match to d1bbsa_
    complexed with 3ig, nag

Details for d2g1ra_

PDB Entry: 2g1r (more details), 2.42 Å

PDB Description: ketopiperazine-based renin inhibitors: optimization of the c ring
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d2g1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1ra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
ssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfdas
dsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefdgv
vgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpqhye
gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
ptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d2g1ra_:

Click to download the PDB-style file with coordinates for d2g1ra_.
(The format of our PDB-style files is described here.)

Timeline for d2g1ra_: