Lineage for d2g1pa_ (2g1p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130085Protein DNA methylase T4DAM [102584] (2 species)
  7. 2130102Species Escherichia coli [TaxId:562] [190028] (2 PDB entries)
  8. 2130103Domain d2g1pa_: 2g1p A: [164541]
    automated match to d2dpma_
    protein/DNA complex; complexed with gol, sah

Details for d2g1pa_

PDB Entry: 2g1p (more details), 1.89 Å

PDB Description: Structure of E. coli DNA adenine methyltransferase (DAM)
PDB Compounds: (A:) DNA adenine methylase

SCOPe Domain Sequences for d2g1pa_:

Sequence, based on SEQRES records: (download)

>d2g1pa_ c.66.1.28 (A:) DNA methylase T4DAM {Escherichia coli [TaxId: 562]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddssvvycdp
pyaplsatanftayhtnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqrakl
hvvkvrrsissnggtrkkvdellalykp

Sequence, based on observed residues (ATOM records): (download)

>d2g1pa_ c.66.1.28 (A:) DNA methylase T4DAM {Escherichia coli [TaxId: 562]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddssvvycdp
pyaplnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkkvdella
lykp

SCOPe Domain Coordinates for d2g1pa_:

Click to download the PDB-style file with coordinates for d2g1pa_.
(The format of our PDB-style files is described here.)

Timeline for d2g1pa_: