Lineage for d1hq3c_ (1hq3 C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637576Protein Histone H3 [47122] (4 species)
  7. 637627Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries)
  8. 637632Domain d1hq3c_: 1hq3 C: [16454]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3d_, d1hq3e_, d1hq3f_, d1hq3h_

Details for d1hq3c_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate
PDB Compounds: (C:) histone h3

SCOP Domain Sequences for d1hq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3c_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
vglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1hq3c_:

Click to download the PDB-style file with coordinates for d1hq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3c_: