Lineage for d1aoih_ (1aoi H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482695Protein Histone H2B [47119] (6 species)
  7. 1482696Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries)
  8. 1482742Domain d1aoih_: 1aoi H: [16453]
    Other proteins in same PDB: d1aoia_, d1aoib_, d1aoic_, d1aoie_, d1aoif_, d1aoig_
    protein/DNA complex; complexed with mn

Details for d1aoih_

PDB Entry: 1aoi (more details), 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d1aoih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoih_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1aoih_:

Click to download the PDB-style file with coordinates for d1aoih_.
(The format of our PDB-style files is described here.)

Timeline for d1aoih_: