![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2B [47119] (3 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries) |
![]() | Domain d1aoih_: 1aoi H: [16453] Other proteins in same PDB: d1aoia_, d1aoib_, d1aoic_, d1aoie_, d1aoif_, d1aoig_ protein/DNA complex; complexed with mn; mutant |
PDB Entry: 1aoi (more details), 2.8 Å
SCOP Domain Sequences for d1aoih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoih_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)} kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr stitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1aoih_: