![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily) core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection |
![]() | Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families) ![]() automatically mapped to Pfam PF06766 |
![]() | Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins) a self-assembling amphiphile |
![]() | Protein automated matches [190650] (1 species) not a true protein |
![]() | Species Hypocrea jecorina [TaxId:51453] [187729] (2 PDB entries) |
![]() | Domain d2fz6d_: 2fz6 D: [164522] automated match to d1r2ma_ complexed with zn |
PDB Entry: 2fz6 (more details), 2.1 Å
SCOPe Domain Sequences for d2fz6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fz6d_ b.138.1.1 (D:) automated matches {Hypocrea jecorina [TaxId: 51453]} nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq allcqtavg
Timeline for d2fz6d_: