Lineage for d2fz6d_ (2fz6 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967483Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 967484Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) (S)
  5. 967485Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
    a self-assembling amphiphile
  6. 967504Protein automated matches [190650] (1 species)
    not a true protein
  7. 967505Species Hypocrea jecorina [TaxId:51453] [187729] (2 PDB entries)
  8. 967513Domain d2fz6d_: 2fz6 D: [164522]
    automated match to d1r2ma_
    complexed with zn

Details for d2fz6d_

PDB Entry: 2fz6 (more details), 2.1 Å

PDB Description: crystal structure of hydrophobin hfbi
PDB Compounds: (D:) Hydrophobin-1

SCOPe Domain Sequences for d2fz6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fz6d_ b.138.1.1 (D:) automated matches {Hypocrea jecorina [TaxId: 51453]}
nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
allcqtavg

SCOPe Domain Coordinates for d2fz6d_:

Click to download the PDB-style file with coordinates for d2fz6d_.
(The format of our PDB-style files is described here.)

Timeline for d2fz6d_: