![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2B [47119] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries) |
![]() | Domain d1aoid_: 1aoi D: [16452] Other proteins in same PDB: d1aoia_, d1aoib_, d1aoic_, d1aoie_, d1aoif_, d1aoig_ protein/DNA complex; complexed with mn |
PDB Entry: 1aoi (more details), 2.8 Å
SCOPe Domain Sequences for d1aoid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoid_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]} kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr stitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1aoid_: