Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins) automatically mapped to Pfam PF00983 |
Protein automated matches [190649] (1 species) not a true protein |
Species Turnip yellow mosaic virus [TaxId:12155] [187728] (2 PDB entries) |
Domain d2fz1b_: 2fz1 B: [164514] automated match to d1auyb_ |
PDB Entry: 2fz1 (more details), 2.9 Å
SCOPe Domain Sequences for d2fz1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fz1b_ b.121.4.6 (B:) automated matches {Turnip yellow mosaic virus [TaxId: 12155]} meidkelapqdrtvtvatvlptvpgpspftikqpfqsevlfagtkdaeasltianidsvs tlttfyrhasleslwvtihptlqapafpttvgvcwvpaqspvtptqitktyggqifcigg aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh splitdtst
Timeline for d2fz1b_: