SCOPe 2.06: Domain d2fyea_: 2fye A:

Lineage for d2fyea_ (2fye A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d2fyea_: 2fye A: [164512]
   automated match to d2g6da1
   complexed with bcq; mutant

Details for d2fyea_

PDB Entry: 2fye, 2.2 Å

PDB Description: mutant human cathepsin s with irreversible inhibitor cra-14013

PDB Compounds: (A:) cathepsin S preproprotein

SCOPe Domain Sequences for d2fyea_:

Sequence; same for both SEQRES and ATOM records:

>d2fyea_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstkk
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydsayraatcrkytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgekgyirmarnkgnhcgiasfpsypei

Timeline for d2fyea_:

• d2fyea_ first appeared in SCOPe 2.01
  
• d2fyea_ appears in SCOPe 2.05
  
• d2fyea_ appears in SCOPe 2.07
  
• d2fyea_ appears in the current release, SCOPe 2.08