Lineage for d2fyaa_ (2fya A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868090Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1868130Protein automated matches [190297] (2 species)
    not a true protein
  7. 1868134Species Human (Homo sapiens) [TaxId:9606] [187395] (17 PDB entries)
  8. 1868136Domain d2fyaa_: 2fya A: [164510]
    automated match to d1tvya_
    complexed with mn, pge; mutant

Details for d2fyaa_

PDB Entry: 2fya (more details), 1.9 Å

PDB Description: crystal structure of the catalytic domain of the human beta1, 4- galactosyltransferase mutant m339h complex with manganese
PDB Compounds: (A:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d2fyaa_:

Sequence, based on SEQRES records: (download)

>d2fyaa_ c.68.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgsaslpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvai
iipfrnrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdyd
ytcfvfsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflti
ngfpnnywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdria
htketmlsdglnsltyqvldvqryplytqitvdigtps

Sequence, based on observed residues (ATOM records): (download)

>d2fyaa_ c.68.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgsaslpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvai
iipfrnrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdyd
ytcfvfsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflti
ngfpnnywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrnpqrfdriahtketm
lsdglnsltyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d2fyaa_:

Click to download the PDB-style file with coordinates for d2fyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2fyaa_: