Lineage for d2fy7a1 (2fy7 A:126-398)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133085Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 protein domains)
  6. 2133143Protein automated matches [190297] (2 species)
    not a true protein
  7. 2133147Species Human (Homo sapiens) [TaxId:9606] [187395] (17 PDB entries)
  8. 2133148Domain d2fy7a1: 2fy7 A:126-398 [164509]
    Other proteins in same PDB: d2fy7a2
    automated match to d1tvya_
    complexed with pge; mutant

Details for d2fy7a1

PDB Entry: 2fy7 (more details), 1.7 Å

PDB Description: Crystal structure of the catalytic domain of the human beta1,4-galactosyltransferase mutant M339H in apo form
PDB Compounds: (A:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d2fy7a1:

Sequence, based on SEQRES records: (download)

>d2fy7a1 c.68.1.2 (A:126-398) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

Sequence, based on observed residues (ATOM records): (download)

>d2fy7a1 c.68.1.2 (A:126-398) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirnpqrfdriahtketmlsdglnsl
tyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d2fy7a1:

Click to download the PDB-style file with coordinates for d2fy7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fy7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fy7a2