Lineage for d2fwmx_ (2fwm X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094898Species Escherichia coli [TaxId:562] [187725] (5 PDB entries)
  8. 2094907Domain d2fwmx_: 2fwm X: [164501]
    automated match to d1i01a_

Details for d2fwmx_

PDB Entry: 2fwm (more details), 2 Å

PDB Description: crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase
PDB Compounds: (X:) 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase

SCOPe Domain Sequences for d2fwmx_:

Sequence, based on SEQRES records: (download)

>d2fwmx_ c.2.1.0 (X:) automated matches {Escherichia coli [TaxId: 562]}
mdfsgknvwvtgagkgigyatalafveagakvtgfdqaftqeqypfatevmdvadaaqva
qvcqrllaeterldalvnaagilrmgatdqlskedwqqtfavnvggafnlfqqtmnqfrr
qrggaivtvasdaahtprigmsaygaskaalkslalsvglelagsgvrcnvvspgstdtd
mqrtlwvsddaeeqrirgfgeqfklgiplgkiarpqeiantilflasdlashitlqdivv
dggstlga

Sequence, based on observed residues (ATOM records): (download)

>d2fwmx_ c.2.1.0 (X:) automated matches {Escherichia coli [TaxId: 562]}
mdfsgknvwvtgagkgigyatalafveagakvtgfdqaftqeqypfatevmdvadaaqva
qvcqrllaeterldalvnaagilrmgatdqlskedwqqtfavnvggafnlfqqtmnqfrr
qrggaivtvasdaahtprigmsaygaskaalkslalsvglelagsgvrcnvvspgstrpq
eiantilflasdlashitlqdivvdggstlga

SCOPe Domain Coordinates for d2fwmx_:

Click to download the PDB-style file with coordinates for d2fwmx_.
(The format of our PDB-style files is described here.)

Timeline for d2fwmx_: