SCOP 1.65: Domain d1f66d_: 1f66 D:

Lineage for d1f66d_ (1f66 D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries)

8. Domain d1f66d_: 1f66 D: [16450]
   Other proteins in same PDB: d1f66a_, d1f66b_, d1f66c_, d1f66e_, d1f66f_, d1f66g_

Details for d1f66d_

PDB Entry: 1f66, 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66d_:

Sequence; same for both SEQRES and ATOM records:

>d1f66d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1f66d_:

• d1f66d_ first appeared (with stable ids) in SCOP 1.55
  
• d1f66d_ appears in SCOP 1.63
  
• d1f66d_ appears in SCOP 1.67
  
• d1f66d_ appears in the current release, SCOPe 2.08