Lineage for d2fw8a_ (2fw8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857184Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2857185Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 2857186Species Acetobacter aceti [TaxId:435] [110480] (11 PDB entries)
    Uniprot Q72LC1
  8. 2857193Domain d2fw8a_: 2fw8 A: [164491]
    automated match to d1u11b_

Details for d2fw8a_

PDB Entry: 2fw8 (more details), 1.75 Å

PDB Description: structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8
PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d2fw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw8a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaaglpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspi

SCOPe Domain Coordinates for d2fw8a_:

Click to download the PDB-style file with coordinates for d2fw8a_.
(The format of our PDB-style files is described here.)

Timeline for d2fw8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fw8b_