SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2fw7b_ (2fw7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102984Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2102985Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 protein domains)
    automatically mapped to Pfam PF00731
  6. 2102986Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 2102987Species Acetobacter aceti [TaxId:435] [110480] (11 PDB entries)
    Uniprot Q72LC1
  8. 2102991Domain d2fw7b_: 2fw7 B: [164490]
    automated match to d1u11b_

Details for d2fw7b_

PDB Entry: 2fw7 (more details), 1.75 Å

PDB Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) H59N from the acidophilic bacterium Acetobacter aceti, at pH 8
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d2fw7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw7b_ c.23.8.1 (B:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
sapvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletwralqtasvpnspite

SCOPe Domain Coordinates for d2fw7b_:

Click to download the PDB-style file with coordinates for d2fw7b_.
(The format of our PDB-style files is described here.)

Timeline for d2fw7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fw7a_