Lineage for d1hiob_ (1hio B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311535Protein Histone H2B [47119] (6 species)
  7. 2311624Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
    Uniprot P02279
  8. 2311634Domain d1hiob_: 1hio B: [16449]
    Other proteins in same PDB: d1hioa_, d1hioc_, d1hiod_

Details for d1hiob_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only
PDB Compounds: (B:) histone h2b

SCOPe Domain Sequences for d1hiob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkhtssk

SCOPe Domain Coordinates for d1hiob_:

Click to download the PDB-style file with coordinates for d1hiob_.
(The format of our PDB-style files is described here.)

Timeline for d1hiob_: