SCOPe 2.06: Domain d1hiob_: 1hio B:

Lineage for d1hiob_ (1hio B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
   Uniprot P02279

8. Domain d1hiob_: 1hio B: [16449]
   Other proteins in same PDB: d1hioa_, d1hioc_, d1hiod_

Details for d1hiob_

PDB Entry: 1hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

PDB Compounds: (B:) histone h2b

SCOPe Domain Sequences for d1hiob_:

Sequence; same for both SEQRES and ATOM records:

>d1hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkhtssk

Timeline for d1hiob_:

• d1hiob_ first appeared (with stable ids) in SCOP 1.55
  
• d1hiob_ appears in SCOPe 2.05
  
• d1hiob_ appears in SCOPe 2.07
  
• d1hiob_ appears in the current release, SCOPe 2.08