Lineage for d2fvub1 (2fvu B:1-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394596Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 2394619Family b.34.12.0: automated matches [191438] (1 protein)
    not a true family
  6. 2394620Protein automated matches [190644] (2 species)
    not a true protein
  7. 2394621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187716] (2 PDB entries)
  8. 2394624Domain d2fvub1: 2fvu B:1-213 [164482]
    Other proteins in same PDB: d2fvua2, d2fvub2
    automated match to d1m4za_

Details for d2fvub1

PDB Entry: 2fvu (more details), 2 Å

PDB Description: Structure of the yeast Sir3 BAH domain
PDB Compounds: (B:) Regulatory protein SIR3

SCOPe Domain Sequences for d2fvub1:

Sequence, based on SEQRES records: (download)

>d2fvub1 b.34.12.0 (B:1-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifnd
nvtetysvyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefyk
dkffnevnkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryacept
aekfvpidifqiirrvkemepkqsdeylkrvsv

Sequence, based on observed residues (ATOM records): (download)

>d2fvub1 b.34.12.0 (B:1-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdldgwqviitdenvflkrisdglsfgkgesvifndnvtetysvyliheirlvei
wvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelseiwlkd
fiavgqilpesqwndssidkiedrdflvryaceptaekfvpidifqiirrvkemepkqsd
eylkrvsv

SCOPe Domain Coordinates for d2fvub1:

Click to download the PDB-style file with coordinates for d2fvub1.
(The format of our PDB-style files is described here.)

Timeline for d2fvub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fvub2