SCOPe 2.01: Domain d2fvub_: 2fvu B:

Lineage for d2fvub_ (2fvu B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.12: BAH domain [82061] (2 families)

5. Family b.34.12.0: automated matches [191438] (1 protein)
   not a true family

6. Protein automated matches [190644] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187716] (2 PDB entries)

8. Domain d2fvub_: 2fvu B: [164482]
   automated match to d1m4za_

Details for d2fvub_

PDB Entry: 2fvu, 2 Å

PDB Description: Structure of the yeast Sir3 BAH domain

PDB Compounds: (B:) Regulatory protein SIR3

SCOPe Domain Sequences for d2fvub_:

Sequence, based on SEQRES records:

>d2fvub_ b.34.12.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmtmaktlkdldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvi
fndnvtetysvyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhple
fykdkffnevnkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryac
eptaekfvpidifqiirrvkemepkqsdeylkrvsv

Sequence, based on observed residues (ATOM records):

>d2fvub_ b.34.12.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmtmaktlkdldgwqviitdenvflkrisdglsfgkgesvifndnvtetysvyliheirl
veiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelseiw
lkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpidifqiirrvkemepk
qsdeylkrvsv

Timeline for d2fvub_:

• d2fvub_ is new in SCOPe 2.01-stable
  
• d2fvub_ appears in SCOPe 2.02
  
• d2fvub_ appears in the current release, SCOPe 2.08, called d2fvub1