SCOPe 2.08: Domain d2fvua1: 2fvu A:1-213

Lineage for d2fvua1 (2fvu A:1-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.12: BAH domain [82061] (2 families)

5. Family b.34.12.0: automated matches [191438] (1 protein)
   not a true family

6. Protein automated matches [190644] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187716] (2 PDB entries)

8. Domain d2fvua1: 2fvu A:1-213 [164481]
   Other proteins in same PDB: d2fvua2, d2fvub2
   automated match to d1m4za_

Details for d2fvua1

PDB Entry: 2fvu, 2 Å

PDB Description: Structure of the yeast Sir3 BAH domain

PDB Compounds: (A:) Regulatory protein SIR3

SCOPe Domain Sequences for d2fvua1:

Sequence, based on SEQRES records:

>d2fvua1 b.34.12.0 (A:1-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifnd
nvtetysvyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefyk
dkffnevnkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryacept
aekfvpidifqiirrvkemepkqsdeylkrvsv

Sequence, based on observed residues (ATOM records):

>d2fvua1 b.34.12.0 (A:1-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maktlkdldgwqviitdnvflkrisdglsfgkgesvifndnvtetysvyliheirlveiw
vfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelseiwlkdf
iavgqilpesqwndssidkiedrdflvryaceptaekfvpidifqiirrvkemepkqsde
ylkrvsv

Timeline for d2fvua1:

• d2fvua1 first appeared in SCOPe 2.01, called d2fvua_
  
• d2fvua1 appears in SCOPe 2.07