SCOP 1.61: Domain d2hiob_: 2hio B:

Lineage for d2hiob_ (2hio B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H2B [47119] (3 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries)

8. Domain d2hiob_: 2hio B: [16448]
   Other proteins in same PDB: d2hioa_, d2hioc_, d2hiod_

Details for d2hiob_

PDB Entry: 2hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

SCOP Domain Sequences for d2hiob_:

Sequence; same for both SEQRES and ATOM records:

>d2hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkytssk

Timeline for d2hiob_:

• d2hiob_ first appeared (with stable ids) in SCOP 1.55
  
• d2hiob_ appears in SCOP 1.59
  
• d2hiob_ appears in SCOP 1.63
  
• d2hiob_ appears in the current release, SCOPe 2.08