Lineage for d2fvlb_ (2fvl B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969532Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 969533Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 969763Protein automated matches [190169] (3 species)
    not a true protein
  7. 969764Species Human (Homo sapiens) [TaxId:9606] [188399] (33 PDB entries)
  8. 969802Domain d2fvlb_: 2fvl B: [164479]
    automated match to d1mrqa_
    complexed with nap

Details for d2fvlb_

PDB Entry: 2fvl (more details), 2.4 Å

PDB Description: Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+
PDB Compounds: (B:) Aldo-keto reductase family 1, member C4

SCOPe Domain Sequences for d2fvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fvlb_ c.1.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpkyqrvelndghfmpvlgfgtyappevprnravevtklaieagfrhidsaylynneeq
vglairskiadgsvkredifytsklwctffqpqmvqpalesslkklqldyvdlyllhfpm
alkpgetplpkdengkvifdtvdlsatwevmekckdaglaksigvsnfnyrqlemilnkp
glkykpvcnqvechpylnqsklldfckskdivlvahsalgtqrhklwvdpnspvlledpv
lcalakkhkrtpalialryqlqrgvvvlaksyneqrireniqvfefqltsedmkvldgln
rnyryvvmdflmdhpdypfsdey

SCOPe Domain Coordinates for d2fvlb_:

Click to download the PDB-style file with coordinates for d2fvlb_.
(The format of our PDB-style files is described here.)

Timeline for d2fvlb_: