Lineage for d2fv0a_ (2fv0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335350Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 proteins)
    Pfam PF07470
  6. 2335351Protein Unsaturated glucuronyl hydrolase [109954] (1 species)
  7. 2335352Species Bacillus sp. GL1 [TaxId:84635] [109955] (4 PDB entries)
    Uniprot Q9RC92
  8. 2335357Domain d2fv0a_: 2fv0 A: [164468]
    automated match to d1vd5a_

Details for d2fv0a_

PDB Entry: 2fv0 (more details), 1.91 Å

PDB Description: ugl_d88n/dglca-glc-rha-glc
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2fv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fv0a_ a.102.1.7 (A:) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d2fv0a_:

Click to download the PDB-style file with coordinates for d2fv0a_.
(The format of our PDB-style files is described here.)

Timeline for d2fv0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fv0b_