SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ftad_ (2fta D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036243Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2036321Protein Azurin [49530] (6 species)
  7. 2036352Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
    Uniprot P00282
  8. 2036419Domain d2ftad_: 2fta D: [164465]
    automated match to d1cc3a_
    complexed with 2pe, cu, eoh, peg

Details for d2ftad_

PDB Entry: 2fta (more details), 1.61 Å

PDB Description: structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpfm"
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d2ftad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftad_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpfmkgtl
tl

SCOPe Domain Coordinates for d2ftad_:

Click to download the PDB-style file with coordinates for d2ftad_.
(The format of our PDB-style files is described here.)

Timeline for d2ftad_: