Lineage for d2ftaa_ (2fta A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2366482Protein Azurin [49530] (6 species)
  7. 2366513Species Pseudomonas aeruginosa [TaxId:287] [49533] (91 PDB entries)
    Uniprot P00282
  8. 2366573Domain d2ftaa_: 2fta A: [164462]
    automated match to d1cc3a_
    complexed with 2pe, cu, eoh, peg

Details for d2ftaa_

PDB Entry: 2fta (more details), 1.61 Å

PDB Description: structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpfm"
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2ftaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ftaa_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpfmkgtl
tl

SCOPe Domain Coordinates for d2ftaa_:

Click to download the PDB-style file with coordinates for d2ftaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ftaa_: