SCOPe 2.01: Domain d2ft8a_: 2ft8 A:

Lineage for d2ft8a_ (2ft8 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (69 PDB entries)
   Uniprot P00282

8. Domain d2ft8a_: 2ft8 A: [164461]
   automated match to d1azna_
   complexed with cu1

Details for d2ft8a_

PDB Entry: 2ft8, 1.55 Å

PDB Description: structure of cu(i)azurin, ph8, with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2ft8a_:

Sequence; same for both SEQRES and ATOM records:

>d2ft8a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpmkgtlt
lk

Timeline for d2ft8a_:

• d2ft8a_ is new in SCOPe 2.01-stable
  
• d2ft8a_ appears in SCOPe 2.02
  
• d2ft8a_ appears in the current release, SCOPe 2.08