Lineage for d1eqzb_ (1eqz B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987350Protein Histone H2B [47119] (6 species)
  7. 1987434Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
    Uniprot P02279
  8. 1987441Domain d1eqzb_: 1eqz B: [16446]
    Other proteins in same PDB: d1eqza_, d1eqzc_, d1eqzd_, d1eqze_, d1eqzg_, d1eqzh_
    protein/DNA complex; complexed with cac, cl, k, mn

Details for d1eqzb_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
PDB Compounds: (B:) protein (histone h2b)

SCOPe Domain Sequences for d1eqzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
vtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiagea
srlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d1eqzb_:

Click to download the PDB-style file with coordinates for d1eqzb_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzb_: