Lineage for d2ft6a_ (2ft6 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940248Protein Azurin [49530] (6 species)
  7. 940279Species Pseudomonas aeruginosa [TaxId:287] [49533] (69 PDB entries)
    Uniprot P00282
  8. 940282Domain d2ft6a_: 2ft6 A: [164459]
    automated match to d1azna_
    complexed with cu

Details for d2ft6a_

PDB Entry: 2ft6 (more details), 1.25 Å

PDB Description: structure of cu(ii)azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "ctphpm"
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2ft6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ft6a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctphpmkgtlt
lk

SCOPe Domain Coordinates for d2ft6a_:

Click to download the PDB-style file with coordinates for d2ft6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ft6a_: