SCOPe 2.01: Domain d2frsa_: 2frs A:

Lineage for d2frsa_ (2frs A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries)

8. Domain d2frsa_: 2frs A: [164449]
   automated match to d1blra_
   complexed with na; mutant

Details for d2frsa_

PDB Entry: 2frs, 1.51 Å

PDB Description: crystal structure of the f15w mutant of apo-cellular retinoic acid binding protein type ii at 1.51 angstroms resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d2frsa_:

Sequence, based on SEQRES records:

>d2frsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenweellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

Sequence, based on observed residues (ATOM records):

>d2frsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenweellkvlgvkpaveikqegdtfyiktsttvrtteinfkvgeefee
qtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeliltmtaddvvctrv
yvre

Timeline for d2frsa_:

• d2frsa_ is new in SCOPe 2.01-stable
  
• d2frsa_ appears in SCOPe 2.02
  
• d2frsa_ appears in the current release, SCOPe 2.08