Lineage for d2fnwb_ (2fnw B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940248Protein Azurin [49530] (6 species)
  7. 940279Species Pseudomonas aeruginosa [TaxId:287] [49533] (69 PDB entries)
    Uniprot P00282
  8. 940296Domain d2fnwb_: 2fnw B: [164448]
    automated match to d1i53a_
    complexed with cu, rep

Details for d2fnwb_

PDB Entry: 2fnw (more details), 1.4 Å

PDB Description: pseudomonas aeruginosa e2q/h83q/m109h-azurin re(phen)(co)3
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d2fnwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnwb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqyhffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d2fnwb_:

Click to download the PDB-style file with coordinates for d2fnwb_.
(The format of our PDB-style files is described here.)

Timeline for d2fnwb_: