Lineage for d2fnwa_ (2fnw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2366482Protein Azurin [49530] (6 species)
  7. 2366513Species Pseudomonas aeruginosa [TaxId:287] [49533] (91 PDB entries)
    Uniprot P00282
  8. 2366525Domain d2fnwa_: 2fnw A: [164447]
    automated match to d1i53a_
    complexed with cu, rep

Details for d2fnwa_

PDB Entry: 2fnw (more details), 1.4 Å

PDB Description: Pseudomonas aeruginosa E2Q/H83Q/M109H-azurin RE(PHEN)(CO)3
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2fnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnwa_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqyhffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d2fnwa_:

Click to download the PDB-style file with coordinates for d2fnwa_.
(The format of our PDB-style files is described here.)

Timeline for d2fnwa_: