Lineage for d2fnca1 (2fnc A:6-377)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916259Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)
  8. 2916268Domain d2fnca1: 2fnc A:6-377 [164443]
    Other proteins in same PDB: d2fnca2
    automated match to d1anfa_

Details for d2fnca1

PDB Entry: 2fnc (more details), 1.7 Å

PDB Description: thermotoga maritima maltotriose binding protein bound with maltotriose.
PDB Compounds: (A:) maltose ABC transporter, periplasmic maltose-binding protein

SCOPe Domain Sequences for d2fnca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnca1 c.94.1.0 (A:6-377) automated matches {Thermotoga maritima [TaxId: 243274]}
kltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivgah
dwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvdsv
pktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdig
lanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdaginy
gvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprlp
arkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedalk
eavekikaqiek

SCOPe Domain Coordinates for d2fnca1:

Click to download the PDB-style file with coordinates for d2fnca1.
(The format of our PDB-style files is described here.)

Timeline for d2fnca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fnca2