Lineage for d2fmja_ (2fmj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064172Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2064356Protein Trypsin [50504] (1 species)
  7. 2064357Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries)
  8. 2064361Domain d2fmja_: 2fmj A: [164440]
    automated match to d1os8a_
    complexed with ca, so4; mutant

Details for d2fmja_

PDB Entry: 2fmj (more details), 1.65 Å

PDB Description: 220-loop mutant of streptomyces griseus trypsin
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d2fmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmja_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
savkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagydtggvdtcqgdsggpmfrkdn
adewiqvgivswgegcarkgkygvytevstfasaiasaartl

SCOPe Domain Coordinates for d2fmja_:

Click to download the PDB-style file with coordinates for d2fmja_.
(The format of our PDB-style files is described here.)

Timeline for d2fmja_: