Lineage for d2fmda_ (2fmd A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044185Species Bowringia mildbraedii [TaxId:28956] [187718] (1 PDB entry)
  8. 2044186Domain d2fmda_: 2fmd A: [164439]
    automated match to d1n3oa_
    complexed with ca, mn

Details for d2fmda_

PDB Entry: 2fmd (more details), 1.9 Å

PDB Description: Structural basis of carbohydrate recognition by Bowringia milbraedii seed agglutinin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2fmda_:

Sequence, based on SEQRES records: (download)

>d2fmda_ b.29.1.0 (A:) automated matches {Bowringia mildbraedii [TaxId: 28956]}
ansvcftftdfesgqqdlifqgdasvgsnkalqltkvdskgnpqggsvgralytapirlw
qssslvasfettftfsisqgsstpadaltffiaspdtkipsgsggrllglfgssnnagsd
ngvvsvefdtypntdigdpnyrhigidvnsirskaaskwdwqngktatahisynsaskrl
svvssypnsspvvvsfdvelnnvbpbwvrvgfsattgqytqtnnilawsfrsslmg

Sequence, based on observed residues (ATOM records): (download)

>d2fmda_ b.29.1.0 (A:) automated matches {Bowringia mildbraedii [TaxId: 28956]}
ansvcftftdfesgqqdlifqgdasvgsnkalqltkvdskgnpqggsvgralytapirlw
qssslvasfettftfsisqgsstpadaltffiaspdtkipsgsggrllglfgssndngvv
svefdtypntdigdpnyrhigidvnsirskaaskwdwqngktatahisynsaskrlsvvs
sypnsspvvvsfdvelnnvbpbwvrvgfsattgqytqtnnilawsfrsslmg

SCOPe Domain Coordinates for d2fmda_:

Click to download the PDB-style file with coordinates for d2fmda_.
(The format of our PDB-style files is described here.)

Timeline for d2fmda_: