Lineage for d2flhc_ (2flh C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215388Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (3 PDB entries)
  8. 2215391Domain d2flhc_: 2flh C: [164430]
    automated match to d1fm4a_
    complexed with na, zea

Details for d2flhc_

PDB Entry: 2flh (more details), 1.2 Å

PDB Description: Crystal structure of cytokinin-specific binding protein from mung bean in complex with cytokinin
PDB Compounds: (C:) cytokinin-specific binding protein

SCOPe Domain Sequences for d2flhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flhc_ d.129.3.0 (C:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
dhdsdieekvtptktsqstlmylrrlerylsn

SCOPe Domain Coordinates for d2flhc_:

Click to download the PDB-style file with coordinates for d2flhc_.
(The format of our PDB-style files is described here.)

Timeline for d2flhc_: