| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (4 species) |
| Species Human (Homo sapiens), variant H2A.Z [TaxId:9606] [47118] (1 PDB entry) |
| Domain d1f66g_: 1f66 G: [16443] Other proteins in same PDB: d1f66a_, d1f66b_, d1f66d_, d1f66e_, d1f66f_, d1f66h_ |
PDB Entry: 1f66 (more details), 2.6 Å
SCOP Domain Sequences for d1f66g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66g_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), variant H2A.Z}
avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
lkvkritprhlqlairgdeeldslikatiagggviphihksligkkg
Timeline for d1f66g_: