SCOP 1.59: Domain d1f66g_: 1f66 G:

Lineage for d1f66g_ (1f66 G:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H2A [47115] (4 species)

7. Species Human (Homo sapiens), variant H2A.Z [TaxId:9606] [47118] (1 PDB entry)

8. Domain d1f66g_: 1f66 G: [16443]
   Other proteins in same PDB: d1f66a_, d1f66b_, d1f66d_, d1f66e_, d1f66f_, d1f66h_

Details for d1f66g_

PDB Entry: 1f66, 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z

SCOP Domain Sequences for d1f66g_:

Sequence; same for both SEQRES and ATOM records:

>d1f66g_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), variant H2A.Z}
avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
lkvkritprhlqlairgdeeldslikatiagggviphihksligkkg

Timeline for d1f66g_:

• d1f66g_ first appeared (with stable ids) in SCOP 1.55
  
• d1f66g_ appears in SCOP 1.57
  
• d1f66g_ appears in SCOP 1.61
  
• d1f66g_ appears in the current release, SCOPe 2.08