Lineage for d2fl7a_ (2fl7 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785089Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 1785108Family b.34.12.0: automated matches [191438] (1 protein)
    not a true family
  6. 1785109Protein automated matches [190644] (2 species)
    not a true protein
  7. 1785110Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187716] (2 PDB entries)
  8. 1785111Domain d2fl7a_: 2fl7 A: [164425]
    automated match to d1m4za_

Details for d2fl7a_

PDB Entry: 2fl7 (more details), 1.85 Å

PDB Description: s. cerevisiae sir3 bah domain
PDB Compounds: (A:) Regulatory protein SIR3

SCOPe Domain Sequences for d2fl7a_:

Sequence, based on SEQRES records: (download)

>d2fl7a_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifndnvtetys
vyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnev
nkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpi
difqiirrvkemepkqsdeylkrvsvpv

Sequence, based on observed residues (ATOM records): (download)

>d2fl7a_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldgwqviitddqgrvienvflkrisdglsfgkgesvifndnvtetysvyliheirlvvei
wvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelseiwlkd
fiavgqilpesqwiedrdflvryaceptaekfvpidifqiirrvkemepkqsdeylkrvs
vpv

SCOPe Domain Coordinates for d2fl7a_:

Click to download the PDB-style file with coordinates for d2fl7a_.
(The format of our PDB-style files is described here.)

Timeline for d2fl7a_: